PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G10530.1
Common NameLOC102710052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 319aa    MW: 35235.4 Da    PI: 10.4472
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G10530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind367.91.9e-11213191301
     GAGA_bind   1 mdddgsre.rnkg.yyepaaslkenlglqlmssia.erdaki..rernlalsekkaavaerd.............maflqrdkalaernkalverdn 79 
                   mddd+++  r +g ++++    ++nlglqlmss++ +rd+k+         +++++ +++rd             ++f++ +++++    ++++r+ 
  OB10G10530.1   1 MDDDANMGmRGWGsFFDSP---ARNLGLQLMSSVPaDRDTKQllSATPFLQHHHHHHHHPRDsvpnaavpadpppINFVRGEMWMHP---QHHPREP 91 
                   99**99999****999988...78**********99******6533333345666667788899999********************...899**** PP

     GAGA_bind  80 kllalllvensla..salpvgvqvlsgtksidslqqlse..pqledsave.lreeeklealpieeaaeeakekk.kkkkrqrakkpkekkakkkkkk 170
                   k+l+ l v ++    +++pv++++++gt+ +++lq++++  pq ++++ + +++ee+++++ iee++++++e++  +kkrq++++pk+++ kk+kk 
  OB10G10530.1  92 KVLHTLAVGHGGHvpHHDPVAYGMIPGTHAAHTLQMMQQpdPQPQQPPPPpVPKEECISSPMIEENVPVVNEQPpPPKKRQQGRQPKVPRPKKPKK- 187
                   **********98889*********************888676666555555***************9998876516789999**************. PP

     GAGA_bind 171 sekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                   +++++++ +++  + +r++ +kk i++v+ng++lD s++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmS+gafk
  OB10G10530.1 188 PAAPREDGAPNPPPaPRRRGPKKAIGMVINGIDLDLSRIPTPVCSCTGSPQQCYRWGAGGWQSACCTTTISTYPLPMSTKRRGARIAGRKMSHGAFK 284
                   7788888877776779********************************************************************************* PP

     GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                   k+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  OB10G10530.1 285 KVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 319
                   **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062179.1E-1241319IPR010409GAGA-binding transcriptional activator
SMARTSM012261.6E-1771319IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDDDANMGMR GWGSFFDSPA RNLGLQLMSS VPADRDTKQL LSATPFLQHH HHHHHHPRDS  60
VPNAAVPADP PPINFVRGEM WMHPQHHPRE PKVLHTLAVG HGGHVPHHDP VAYGMIPGTH  120
AAHTLQMMQQ PDPQPQQPPP PPVPKEECIS SPMIEENVPV VNEQPPPPKK RQQGRQPKVP  180
RPKKPKKPAA PREDGAPNPP PAPRRRGPKK AIGMVINGID LDLSRIPTPV CSCTGSPQQC  240
YRWGAGGWQS ACCTTTISTY PLPMSTKRRG ARIAGRKMSH GAFKKVLEKL AGEGYNLNNP  300
IDLKTFWAKH GTNKFVTIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126181e-170CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006661604.10.0PREDICTED: barley B recombinant-like protein A isoform X2
SwissprotP0DH881e-157BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH891e-157BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLJ3N0K50.0J3N0K5_ORYBR; Uncharacterized protein
STRINGOB10G10530.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-59basic pentacysteine 2